PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009149543.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 817aa    MW: 91316.7 Da    PI: 5.7615
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009149543.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.2e-29533583252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      k+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  XP_009149543.1 533 DKTITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 583
                     689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.166520603IPR003035RWP-RK domain
PfamPF020421.8E-25535583IPR003035RWP-RK domain
SuperFamilySSF542772.36E-22710805No hitNo description
Gene3DG3DSA:3.10.20.2403.9E-21716797No hitNo description
PROSITE profilePS5174528.812717800IPR000270PB1 domain
SMARTSM006664.9E-26717800IPR000270PB1 domain
PfamPF005641.8E-18718799IPR000270PB1 domain
CDDcd064071.89E-43719799No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 817 aa     Download sequence    Send to blast
MEDSFLQTQN AVMDTEFMDG LLLDGCWLET TDGSEFLNLP PSTPFDPSSF MWSPPTQDTS  60
AICTSGVVSQ TYGQDCADEF QWNKRWWIGP GGGGGSSVTE RLVQAVEHIK DYTTERGSLI  120
QLWVPVNRGG KRVLTTKEQP FSHDPMCQRL ANYREISVNY HFSAEQDDSK ALAGLPGRVF  180
LGKLPEWTPD VRFFKSEEYP RVQHAQDCDV RGTLAIPVFE QGSKICLGVI EVVMTTEMVK  240
LKPELESICR ALQAVDLRST ELPVPPSLKG CDLSYKAALP EIRNLLRCAC ETHKLPLAQT  300
WVSCLQQNKS GCRHNDENYI HCVSTIDDAC YLGDPTVREF QEACSEHHLL KGQGVAGQAF  360
LTNGPCFSPD VSNYKKSEYP LSHHANMFGL HGAVAIRLRC IHTGDADFVL EFFLPKDCDN  420
MEEQRRMLNA LSTIMAHVPR SLRTVTDKEL EEESEVVERE EVVTPKIENT SELHHSNPQN  480
LGLVFDGGDK LPSDGFGLKR GYDYTRESNI NESNTFTSGG FNSMAEKKRT KADKTITLDV  540
LRQYFAGSLK DAAKSIGVCP TTLKRICRQH GIQRWPSRKI KKVGHSLQKI QRVIDSVEGV  600
SGPLPIGSFY ANFPNLASQE PSQQPKTSPP PPPPPPLQLS KSPVSQYSHS SSSSQCCSSE  660
TQLNSSATAH PSQGDTFKKV SSEVDLQSSV LTLSSLENIP QGQGTHLLSS SSQDDDSLRI  720
KVSYGEENIR FRMKNSRRLS DLQWEIGKRF SIEDMSRYDL KYLDEDNEWV LLTCDEDVEE  780
CVDVCRTTPS HTIKLLLHAS SHHFPERSSP TGYTLWQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.181660.0root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892470.0AC189247.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB018K09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149543.10.0PREDICTED: protein NLP4
RefseqXP_009149544.10.0PREDICTED: protein NLP4
RefseqXP_009149545.10.0PREDICTED: protein NLP4
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLM4EAM50.0M4EAM5_BRARP; Uncharacterized protein
STRINGBra025834.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein